PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_24526
Common NameKK1_025742
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 286aa    MW: 31090.4 Da    PI: 8.9633
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_24526genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding635.8e-20550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G+++W++I+r ++ gR++k+c++rw + 
    C.cajan_24526  5 KGPWSPEEDEALQRLVEKHGPRNWSLISRSIP-GRSGKSCRLRWCNQ 50
                     79******************************.***********985 PP

2Myb_DNA-binding53.94e-1759101347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
    C.cajan_24526  59 AFTPEEDDTIIRAHARFGNK-WATIARLLH-GRTDNAIKNHWNST 101
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.777155IPR017930Myb domain
SuperFamilySSF466899.73E-33298IPR009057Homeodomain-like
SMARTSM007176.9E-18453IPR001005SANT/Myb domain
PfamPF002493.8E-19550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-26658IPR009057Homeodomain-like
CDDcd001672.16E-17749No hitNo description
SMARTSM007175.1E-1456104IPR001005SANT/Myb domain
PROSITE profilePS5129420.44557106IPR017930Myb domain
PfamPF002497.7E-1559101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2359105IPR009057Homeodomain-like
CDDcd001671.58E-1159102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MDRIKGPWSP EEDEALQRLV EKHGPRNWSL ISRSIPGRSG KSCRLRWCNQ LSPQVEHRAF  60
TPEEDDTIIR AHARFGNKWA TIARLLHGRT DNAIKNHWNS TLKRKCSSAM IDDIQPLKRS  120
VSAGAAIPVS TGLYINPPTP GSPSGSDVSE SSVPVASPSH VYRPVARPGP VLPPVETTSS  180
SNDPPPSLPL SLPGADSSEV SNHAAPPPPP PSNTIPLLPM MAAPVPPPPV MGPFNLSAEF  240
LAVMQEMIRK EVRSYMEMQN GMCFHAADDG FRNASVKRIG ISRIDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-4041063105C-Myb DNA-Binding Domain
1mse_C1e-4041063105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312621e-177KT031262.1 Glycine max clone HN_CCL_49 MYB/HD-like transcription factor (Glyma11g05550.1_like1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521508.11e-175PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-97MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A151SCD00.0A0A151SCD0_CAJCA; Transcription factor MYB44
STRINGGLYMA11G05550.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-80myb domain protein r1